PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00068.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 465aa    MW: 52699.9 Da    PI: 6.367
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00068.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding377.7e-123074348
                             SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              W+++Ed++l + + + G+ +W+ Ia+++   ++  qc+ rw++yl
  Rsa1.0_00068.1_g00018.1 30 TWSPQEDDILRQQISLNGTQNWAIIASKFT-DKSTRQCRRRWYTYL 74
                             6****************************9.*************97 PP

2Myb_DNA-binding46.21e-1480123146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg WT+eEd ll +a +++G++ W+ Ia+ +  gRt++ +k+r+ +
  Rsa1.0_00068.1_g00018.1  80 RGGWTPEEDTLLCEAQRLFGNR-WTEIAKVVS-GRTDNAVKNRFTT 123
                              789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.03E-91871IPR009057Homeodomain-like
PROSITE profilePS5129413.7542374IPR017930Myb domain
SMARTSM007171.1E-112776IPR001005SANT/Myb domain
CDDcd001671.92E-103074No hitNo description
PfamPF139212.5E-143191No hitNo description
Gene3DG3DSA:1.10.10.607.4E-193182IPR009057Homeodomain-like
SuperFamilySSF466899.88E-2554133IPR009057Homeodomain-like
PROSITE profilePS5129421.25475129IPR017930Myb domain
SMARTSM007174.0E-1579127IPR001005SANT/Myb domain
CDDcd001674.60E-1183124No hitNo description
Gene3DG3DSA:1.10.10.602.9E-1983128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MEETRKKRKN KILVNNEEDD SKKKERHFVT WSPQEDDILR QQISLNGTQN WAIIASKFTD  60
KSTRQCRRRW YTYLNSDFKR GGWTPEEDTL LCEAQRLFGN RWTEIAKVVS GRTDNAVKNR  120
FTTLCKKRAK YEAMAKENNI ASSVNSNNKR ILLPDGITTP LKVETESPLA KKTRRSHIPN  180
LKEITSYGDR SHIKVHSGVN QQAKPVLLPH NATIEEHQTG ERKGNQQVFL KKDDPKVTNL  240
MQQAELLSSL AHKVNSDNTE QSMENAWKVL QDFLNKSKEN DIFRCGLPEM DYQLEEFKDL  300
VEDLRSSNED IQASYRQPDL HDSPASSENS SGSNVMPFPS GDDTQQQPMH DSQTISQNGV  360
ELVQDKGTVS DDAIVEQQVD LLSTCHDVLK NSNEIVPMSG DEEFNSPVQV TPLFRSLAAG  420
IPSPQFSESE RSFLLKTLGV ESPYPCPSAN PSQPPPCKRV LLDSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_J4e-25351559116MYB3
3zqc_G4e-25351559116MYB3
3zqc_D4e-25351559116MYB3
3zqc_A4e-25351559116MYB3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013692350.10.0PREDICTED: myb-related protein B-like
TrEMBLA0A078HY590.0A0A078HY59_BRANA; BnaC02g34810D protein
STRINGBra026578.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.20.0myb domain protein 88